Bevacizumab (Anti-VEGF-A) Recombinant Antibody – Functional Grade
Price range: $600.00 through $15,000.00
Humanized monoclonal IgG1 antibody targeting VEGF-A (vascular endothelial growth factor A).
Description
Bevacizumab is a humanized monoclonal IgG1 antibody that targets vascular endothelial growth factor A (VEGF-A), a key driver of angiogenesis. By binding VEGF-A and preventing its interaction with VEGF receptors, bevacizumab inhibits vascular development pathways and is widely used in studies of tumor biology and angiogenic signaling.
Additional information
| Source | DrugBank DB00112 |
|---|---|
| Buffer | PBS pH 7.4 |
| Reactivity | Human |
| Immunogen | Recombinant human VEGF-A (vascular endothelial growth factor A) |
| Isotype | IgG1 |
| Application | ELISA, WB |
| Heavy Chain Sequence | EVQLVESGGGLVQPGGSLRLSCAASGYTFTNYGMNWVRQAPGKGLEWVGWINTYTGEPTY |
| Light Chain Sequence | DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPS |
| Format | Liquid |
| Endotoxins | Endotoxin Free |
| Notes | For research use only. Not suitable for clinical or therapeutic use. |
| Delivery Time | 3-5 days if in stock; 3-5 weeks if out of stock |
| Stability and Storage | Store at 4°C short term (1-2 weeks). Store at -20°C 12 months. Store at -80°C long term. Avoid repeated freeze-thaw cycles. |
| Synonyms et alternative names | Anti-VEGF-A, anti-VEGF-A165, anti-VEGF, anti-vascular endothelial growth factor A |
| Reference Product | Avastin® (bevacizumab) Avastin® is a registered trademark of Genentech, Inc. This product is not affiliated with, endorsed by, or manufactured by Genentech, Inc. or Roche. |
Related products
-
Infliximab (Anti-TNF-α) Recombinant Antibody – Functional Grade
Price range: $600.00 through $15,000.00Select options This product has multiple variants. The options may be chosen on the product page -
Adalimumab (Anti-TNF-α) Recombinant Antibody – Functional Grade
Price range: $600.00 through $15,000.00Select options This product has multiple variants. The options may be chosen on the product page -
SARS-CoV-2 mAb (CV3-25)
Price range: $600.00 through $15,000.00Select options This product has multiple variants. The options may be chosen on the product page -
Trastuzumab (Anti-HER2) Recombinant Antibody – Functional Grade
Price range: $600.00 through $15,000.00Select options This product has multiple variants. The options may be chosen on the product page
