Adalimumab (Anti-TNF-α) Recombinant Antibody – Functional Grade
Price range: $600.00 through $15,000.00
Fully human monoclonal IgG1 antibody targeting TNF-α (tumor necrosis factor alpha)
Description
Adalimumab is a fully human monoclonal IgG1 antibody that specifically targets tumor necrosis factor alpha (TNF-α), a key mediator of inflammatory processes. Through high-affinity binding to TNF-α, adalimumab blocks cytokine interaction with its receptors and is frequently used in studies of immune regulation and chronic inflammation.
Additional information
| Source | DrugBank DB00051 |
|---|---|
| Buffer | PBS pH 7.5 |
| Reactivity | Human |
| Immunogen | Recombinant human TNF-α (tumor necrosis factor alpha) |
| Isotype | IgG1 |
| Application | ELISA, WB |
| Heavy Chain Sequence | EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDY |
| Light Chain Sequence | DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPS |
| Format | Liquid |
| Endotoxins | Endotoxin Free |
| Notes | For research use only. Not suitable for clinical or therapeutic use. |
| Delivery Time | 3-5 days if in stock; 3-5 weeks if out of stock |
| Stability and Storage | Store at 4°C short term (1-2 weeks). Store at -20°C 12 months. Store at -80°C long term. Avoid repeated freeze-thaw cycles. |
| Synonyms and Alternative Names | Anti-TNF-α, anti-TNF-alpha, anti-TNFA, anti-TNF-a, anti-TNF, anti-tumor necrosis factor alpha |
| Reference Product | Humira® (adalimumab, anti-TNFα) Humira® is a registered trademark of AbbVie Inc. This product is not affiliated with, endorsed by, or manufactured by AbbVie Inc. |
Related products
-
Trastuzumab (Anti-HER2) Recombinant Antibody – Functional Grade
Price range: $600.00 through $15,000.00Select options This product has multiple variants. The options may be chosen on the product page -
Infliximab (Anti-TNF-α) Recombinant Antibody – Functional Grade
Price range: $600.00 through $15,000.00Select options This product has multiple variants. The options may be chosen on the product page -
SARS-CoV-2 mAb (CV3-25)
Price range: $600.00 through $15,000.00Select options This product has multiple variants. The options may be chosen on the product page -
Rituximab (Anti-CD20) Recombinant Antibody – Functional Grade
Price range: $600.00 through $15,000.00Select options This product has multiple variants. The options may be chosen on the product page
