Infliximab (Anti-TNF-α) Recombinant Antibody – Functional Grade
Price range: $600.00 through $15,000.00
Chimeric monoclonal IgG1 antibody targeting TNF-α (tumor necrosis factor alpha)
Description
Infliximab is a chimeric monoclonal IgG1 antibody directed against tumor necrosis factor alpha (TNF-α), a pro-inflammatory cytokine involved in immune regulation. By binding soluble and membrane-bound TNF-α, infliximab suppresses inflammatory responses and serves as a widely used tool in cytokine signaling and immunology research.
Additional information
| Source | DrugBank DB00065 |
|---|---|
| Buffer | PBS pH 7.4 |
| Reactivity | Human |
| Immunogen | Recombinant human TNF-α (tumor necrosis factor alpha) |
| Isotype | IgG1 |
| Application | ELISA, WB |
| Heavy Chain Sequence | EVKLEESGGGLVQPGGSMKLSCVASGFIFSNHWMNWVRQSPEKGLEWVAEIRSKSINSAT |
| Light Chain Sequence | DILLTQSPAILSVSPGERVSFSCRASQFVGSSIHWYQQRTNGSPRLLIKYASESMSGIPS |
| Format | Liquid |
| Endotoxins | Endotoxin Free |
| Notes | For research use only. Not suitable for clinical or therapeutic use. |
| Delivery Time | 3-5 days if in stock; 3-5 weeks if out of stock |
| Stability and Storage | Store at 4°C short term (1-2 weeks). Store at -20°C 12 months. Store at -80°C long term. Avoid repeated freeze-thaw cycles. |
| Synonyms et Alternative Names | Anti-TNF-α, anti-TNF-alpha, anti-TNFA, anti-TNF-a, anti-TNF, anti-tumor necrosis factor alpha |
| Reference Product | Remicade® (infliximab) Remicade® is a registered trademark of Janssen Biotech, Inc. and Merck & Co., Inc. This product is not affiliated with, endorsed by, or manufactured by Janssen Biotech, Inc., Merck & Co., Inc., or their affiliates. |
Related products
-
Bevacizumab (Anti-VEGF-A) Recombinant Antibody – Functional Grade
Price range: $600.00 through $15,000.00Select options This product has multiple variants. The options may be chosen on the product page -
Rituximab (Anti-CD20) Recombinant Antibody – Functional Grade
Price range: $600.00 through $15,000.00Select options This product has multiple variants. The options may be chosen on the product page -
Trastuzumab (Anti-HER2) Recombinant Antibody – Functional Grade
Price range: $600.00 through $15,000.00Select options This product has multiple variants. The options may be chosen on the product page -
Adalimumab (Anti-TNF-α) Recombinant Antibody – Functional Grade
Price range: $600.00 through $15,000.00Select options This product has multiple variants. The options may be chosen on the product page
