Rituximab (Anti-CD20) Recombinant Antibody – Functional Grade
Price range: $600.00 through $15,000.00
Chimeric monoclonal IgG1 antibody targeting CD20 (MS4A1)
Description
Rituximab is a chimeric monoclonal IgG1 antibody that recognizes the CD20 antigen (MS4A1) present on the surface of B cells. Binding to CD20 leads to B cell depletion via immune effector mechanisms and makes rituximab a widely utilized reagent in immunology and B cell-related research applications.
Additional information
| Source | DrugBank DB00073 |
|---|---|
| Buffer | PBS pH 7.4 |
| Reactivity | Human |
| Immunogen | Recombinant human CD20 (MS4A1) |
| Isotype | IgG1 |
| Application | ELISA, WB |
| Heavy Chain Sequence | QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSY |
| Light Chain Sequence | QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVR |
| Format | Liquid |
| Endotoxins | Endotoxin Free |
| Notes | For research use only. Not suitable for clinical or therapeutic use. |
| Delivery Time | 3-5 days if in stock; 3-5 weeks if out of stock |
| Stability and Storage | Store at 4°C short term (1-2 weeks). Store at -20°C 12 months. Store at -80°C long term. Avoid repeated freeze-thaw cycles. |
| Synonyms and Alternative Names | Anti-CD20, anti-MS4A1, anti-B-lymphocyte antigen CD20 |
| Reference Product | Rituxan® / MabThera® (rituximab) Rituxan® is a registered trademark of Genentech, Inc. MabThera® is a registered trademark of Roche. This product is not affiliated with, endorsed by, or manufactured by Genentech, Roche, or Biogen. |
Related products
-
Infliximab (Anti-TNF-α) Recombinant Antibody – Functional Grade
Price range: $600.00 through $15,000.00Select options This product has multiple variants. The options may be chosen on the product page -
SARS-CoV-2 mAb (CV3-25)
Price range: $600.00 through $15,000.00Select options This product has multiple variants. The options may be chosen on the product page -
Bevacizumab (Anti-VEGF-A) Recombinant Antibody – Functional Grade
Price range: $600.00 through $15,000.00Select options This product has multiple variants. The options may be chosen on the product page -
Adalimumab (Anti-TNF-α) Recombinant Antibody – Functional Grade
Price range: $600.00 through $15,000.00Select options This product has multiple variants. The options may be chosen on the product page
